This solicitation is being issued on an unrestricted basis to allow for full and open competition. The associated NAICS code is 334419. Offerors must also be registered in Systems for Award Management (SAM) at www.sam.gov per FAR 52.212.1 lack of registration in SAM will qualify contractor as ineligible for award. All responsible sources may submit a quotation in response to this solicitationwhich shall be considered.The solicitation is being issued as a Request for Quote (RFQ) for a firm fixed type contract based on the lowest Price Technically Acceptable. The Naval Medical Research Center (NMRC) intends to award a contract resulting from this solicitation to the responsible offeror. all offers must have a DUN & Bradstreet Number. A Dun & Bradstreet number may be acquired free of charge by contacting Dun & Bradstreet online at https://www.dnb.com/products/eupdate/requestOptions.html or by phone at (800) 333-0505.

This will be for a Base Year with one Option Year Period. Attached SOW / PWS.

Peptide #1
Peptide name: PLA2-1(41-50 aa)
Sequence (N to C):
KKMTGKSGMLWYSAYGCYCGWGGQGRPKDATDRCCFVHDCCYGKVTGCN
Quantity: 5mg
HPLC purity: >95%
N-terminus: Free
C-terminus: Free
Modifications: None
Aliquots: 5*1mg
Salt form: TFA salt
Estimated Turnaround Time:4-5 weeks
Comment: Customer will accept addition of ddt to prevent oxidation


Peptide #2
Peptide name: PLA2-2 (51-60 aa)
Sequence (N to C):
KKMTGKSGMLWYSAYGCYCGWGGQGRPKDATDRCCFVHDCCYGKVTGCNPKMDIYTY
Quantity: 5mg
HPLC purity: >95%
N-terminus: Free
C-terminus: Free
Modifications: None
Aliquots: 5*1mg
Salt form: TFA salt
Estimated Turnaround Time: 4-6 weeks
Comment: Customer will accept addition of ddt to prevent oxidation

Bid Protests Not Available